Anti LACTB pAb (ATL-HPA036362)

Atlas Antibodies

Catalog No.: ATL-HPA036362-25

Protein Description: lactamase, beta
Gene Name: LACTB
Alternative Gene Name: FLJ14902, MRPL56
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032370: 84%, ENSRNOG00000018081: 84%
Entrez Gene ID: 114294
Uniprot ID: P83111
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KEGKSNEKNDFTKFKTEQENEAKCRNSKPGKKKNDFEQGELYLREKFENSIESLRLFKNDPLFFKPGSQFLYSTFGYTLL
• Gene Sequence: KEGKSNEKNDFTKFKTEQENEAKCRNSKPGKKKNDFEQGELYLREKFENSIESLRLFKNDPLFFKPGSQFLYSTFGYTLL
• Gene ID - Mouse: ENSMUSG00000032370
• Gene ID - Rat: ENSRNOG00000018081
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.