Anti KTI12 pAb (ATL-HPA031205 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA031205-25

Protein Description: KTI12 homolog, chromatin associated (S. cerevisiae)
Gene Name: KTI12
Alternative Gene Name: MGC20419, SBBI81, TOT4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000073775: 88%, ENSRNOG00000006178: 26%
Entrez Gene ID: 112970
Uniprot ID: Q96EK9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VYVVDDAAVLGAEDPAVYGDSAREKALRGALRASVERRLSRHDVVILDSLNYIKGFRYELYCLAR
• Gene Sequence: VYVVDDAAVLGAEDPAVYGDSAREKALRGALRASVERRLSRHDVVILDSLNYIKGFRYELYCLAR
• Gene ID - Mouse: ENSMUSG00000073775
• Gene ID - Rat: ENSRNOG00000006178
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.