Anti KRT73 pAb (ATL-HPA044031 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA044031-25

Protein Description: keratin 73
Gene Name: KRT73
Alternative Gene Name: K6IRS3, KRT6IRS3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000063661: 69%, ENSRNOG00000025087: 70%
Entrez Gene ID: 319101
Uniprot ID: Q86Y46
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VINSSMAGMAGTGAGFGFSNAGTYGYWPSSVSGGYSMLPGGCVTGSGNCSPRGEARTRLGSASEFRDSQGKTLA
• Gene Sequence: VINSSMAGMAGTGAGFGFSNAGTYGYWPSSVSGGYSMLPGGCVTGSGNCSPRGEARTRLGSASEFRDSQGKTLA
• Gene ID - Mouse: ENSMUSG00000063661
• Gene ID - Rat: ENSRNOG00000025087
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.