Anti KRT13 pAb (ATL-HPA069771 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA069771-25

Protein Description: keratin 13
Gene Name: KRT13
Alternative Gene Name: CK13, K13, MGC161462, MGC3781
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034681: 37%, ENSRNOG00000008703: 37%
Entrez Gene ID: 3860
Uniprot ID: P13646
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EGQDAKMIGFPSSAGSVSPRSTSVTTTSSASVTTTSNASGRRTSDVRRP
• Gene Sequence: EGQDAKMIGFPSSAGSVSPRSTSVTTTSSASVTTTSNASGRRTSDVRRP
• Gene ID - Mouse: ENSMUSG00000034681
• Gene ID - Rat: ENSRNOG00000008703
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.