Anti KRR1 pAb (ATL-HPA043433 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA043433-25

Protein Description: KRR1, small subunit (SSU) processome component, homolog (yeast)
Gene Name: KRR1
Alternative Gene Name: HRB2, RIP-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000063334: 91%, ENSRNOG00000004035: 91%
Entrez Gene ID: 11103
Uniprot ID: Q13601
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LKANQKKRQKMEAIKAKQAEAISKRQEERNKAFIPPKEKPIVKPKEASTETKIDVASIKEKVKKAKNKKLGALTAEEIALKMEAD
• Gene Sequence: LKANQKKRQKMEAIKAKQAEAISKRQEERNKAFIPPKEKPIVKPKEASTETKIDVASIKEKVKKAKNKKLGALTAEEIALKMEAD
• Gene ID - Mouse: ENSMUSG00000063334
• Gene ID - Rat: ENSRNOG00000004035
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.