Anti KMT2C pAb (ATL-HPA074736)

Atlas Antibodies

Catalog No.: ATL-HPA074736-25

Protein Description: lysine (K)-specific methyltransferase 2C
Gene Name: KMT2C
Alternative Gene Name: HALR, KIAA1506, MLL3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038056: 88%, ENSRNOG00000006718: 33%
Entrez Gene ID: 58508
Uniprot ID: Q8NEZ4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TPPTMSQPTFPMVPQQLQHQQHTTVISGHTSPVRMPSLPGWQPNSAPAHLPLNPPRIQPPIAQLPIKTCTPAPGTVSNANPQ
• Gene Sequence: TPPTMSQPTFPMVPQQLQHQQHTTVISGHTSPVRMPSLPGWQPNSAPAHLPLNPPRIQPPIAQLPIKTCTPAPGTVSNANPQ
• Gene ID - Mouse: ENSMUSG00000038056
• Gene ID - Rat: ENSRNOG00000006718
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.