Anti KLHL32 pAb (ATL-HPA039150 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA039150-25

Protein Description: kelch-like family member 32
Gene Name: KLHL32
Alternative Gene Name: BKLHD5, KIAA1900
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040387: 98%, ENSRNOG00000007441: 99%
Entrez Gene ID: 114792
Uniprot ID: Q96NJ5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TSLSEEQIWQLAVRWLEHNCHYQYMDELLQYIRFGLMDVDTLHTVALSHPLVQASETATALVNEALEYHQSIYAQPVWQTRRTKPRFQS
• Gene Sequence: TSLSEEQIWQLAVRWLEHNCHYQYMDELLQYIRFGLMDVDTLHTVALSHPLVQASETATALVNEALEYHQSIYAQPVWQTRRTKPRFQS
• Gene ID - Mouse: ENSMUSG00000040387
• Gene ID - Rat: ENSRNOG00000007441
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.