Anti KLHL15 pAb (ATL-HPA065730)

Atlas Antibodies

Catalog No.: ATL-HPA065730-25

Protein Description: kelch-like family member 15
Gene Name: KLHL15
Alternative Gene Name: KIAA1677
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043929: 100%, ENSRNOG00000006515: 100%
Entrez Gene ID: 80311
Uniprot ID: Q96M94
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DQWTILASMPIGRSGHGVTVLDKQIMVLGGLCYNGHYSDSILTFDPDENKWKEDEYPRMPCKLDGLQVCNLHFPDYVLDEVRRCN
• Gene Sequence: DQWTILASMPIGRSGHGVTVLDKQIMVLGGLCYNGHYSDSILTFDPDENKWKEDEYPRMPCKLDGLQVCNLHFPDYVLDEVRRCN
• Gene ID - Mouse: ENSMUSG00000043929
• Gene ID - Rat: ENSRNOG00000006515
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.