Anti KLHL10 pAb (ATL-HPA067538 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA067538-25

• 

Protein Description: kelch-like family member 10
Gene Name: KLHL10
Alternative Gene Name: FLJ32662
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001558: 100%, ENSRNOG00000016749: 100%
Entrez Gene ID: 317719
Uniprot ID: Q6JEL2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AVGGFDGANRLRSAEAYSPVANTWRTIPTMFNPRSNFGIEVVDDLLFVVGGFNGFTTTFNVECYDEKTDEWYDAHDMSIYRSALSCCVVPGLA
• Gene Sequence: AVGGFDGANRLRSAEAYSPVANTWRTIPTMFNPRSNFGIEVVDDLLFVVGGFNGFTTTFNVECYDEKTDEWYDAHDMSIYRSALSCCVVPGLA
• Gene ID - Mouse: ENSMUSG00000001558
• Gene ID - Rat: ENSRNOG00000016749
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.