Anti KLHDC7A pAb (ATL-HPA056616)

Atlas Antibodies

Catalog No.: ATL-HPA056616-25

Protein Description: kelch domain containing 7A
Gene Name: KLHDC7A
Alternative Gene Name: FLJ38753
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000078234: 76%, ENSRNOG00000018867: 79%
Entrez Gene ID: 127707
Uniprot ID: Q5VTJ3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: CATYRTPYPDAFQCAVVDNLIYCVGRRSTLCFLADSVSPRFVPKELRSFPAPQGTLLPTVLTLPTPDLPQTR
• Gene Sequence: CATYRTPYPDAFQCAVVDNLIYCVGRRSTLCFLADSVSPRFVPKELRSFPAPQGTLLPTVLTLPTPDLPQTR
• Gene ID - Mouse: ENSMUSG00000078234
• Gene ID - Rat: ENSRNOG00000018867
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.