Anti KLF3 pAb (ATL-HPA049512)

Atlas Antibodies

Catalog No.: ATL-HPA049512-25

Protein Description: Kruppel-like factor 3 (basic)
Gene Name: KLF3
Alternative Gene Name: BKLF
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029178: 96%, ENSRNOG00000002163: 99%
Entrez Gene ID: 51274
Uniprot ID: P57682
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SYEKPISQKKIKIEPGIEPQRTDYYPEEMSPPLMNSVSPPQALLQENHPSVIVQPGKRPLPVESPDTQRKR
• Gene Sequence: SYEKPISQKKIKIEPGIEPQRTDYYPEEMSPPLMNSVSPPQALLQENHPSVIVQPGKRPLPVESPDTQRKR
• Gene ID - Mouse: ENSMUSG00000029178
• Gene ID - Rat: ENSRNOG00000002163
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.