Anti KIF20A pAb (ATL-HPA036910 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA036910-25

Protein Description: kinesin family member 20A
Gene Name: KIF20A
Alternative Gene Name: RAB6KIFL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003779: 78%, ENSRNOG00000024428: 77%
Entrez Gene ID: 10112
Uniprot ID: O95235
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DDVVVSPMFESTAADLGSVVRKNLLSDCSVVSTSLEDKQQVPSEDSMEKVKVYLRVRPLLPSELERQEDQGCVRIENVETLVLQAPKDSFAL
• Gene Sequence: DDVVVSPMFESTAADLGSVVRKNLLSDCSVVSTSLEDKQQVPSEDSMEKVKVYLRVRPLLPSELERQEDQGCVRIENVETLVLQAPKDSFAL
• Gene ID - Mouse: ENSMUSG00000003779
• Gene ID - Rat: ENSRNOG00000024428
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti KIF20A pAb (ATL-HPA036910 w/enhanced validation) – 1 Found

Li, Han; Zhang, Weijing; Sun, Xiaoying; Chen, Jueming; Li, Yue; Niu, Chunhao; Xu, Benke; Zhang, Yanna. Overexpression of kinesin family member 20A is associated with unfavorable clinical outcome and tumor progression in epithelial ovarian cancer. Cancer Management And Research. 10( 30254487):3433-3450.