Anti KIF20A pAb (ATL-HPA036909)

Atlas Antibodies

Catalog No.: ATL-HPA036909-100

Protein Description: kinesin family member 20A
Gene Name: KIF20A
Alternative Gene Name: RAB6KIFL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003779: 83%, ENSRNOG00000024428: 84%
Entrez Gene ID: 10112
Uniprot ID: O95235
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PLLSNEVIWLDSKQIRQEEMKKLSLLNGGLQEEELSTSLKRSVYIESRIGTSTSFDSGIAGLSSISQCTSSSQLDETSHRWAQPDTAPLPVPA
• Gene Sequence: PLLSNEVIWLDSKQIRQEEMKKLSLLNGGLQEEELSTSLKRSVYIESRIGTSTSFDSGIAGLSSISQCTSSSQLDETSHRWAQPDTAPLPVPA
• Gene ID - Mouse: ENSMUSG00000003779
• Gene ID - Rat: ENSRNOG00000024428
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.