Anti KIF16B pAb (ATL-HPA051198)

Atlas Antibodies

Catalog No.: ATL-HPA051198-25

Protein Description: kinesin family member 16B
Gene Name: KIF16B
Alternative Gene Name: C20orf23, dJ971B4.1, FLJ20135, SNX23
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038844: 56%, ENSRNOG00000004951: 62%
Entrez Gene ID: 55614
Uniprot ID: Q96L93
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KLVNLEKDLVQQKDILKKEVQEEQEILECLKCEHDKESRLLEKHDESVTDVTEVPQDFEKIKPVEYRLQYKERQLQYLLQNHLPTLLEEKQ
• Gene Sequence: KLVNLEKDLVQQKDILKKEVQEEQEILECLKCEHDKESRLLEKHDESVTDVTEVPQDFEKIKPVEYRLQYKERQLQYLLQNHLPTLLEEKQ
• Gene ID - Mouse: ENSMUSG00000038844
• Gene ID - Rat: ENSRNOG00000004951
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.