Anti KIAA1468 pAb (ATL-HPA040038)

Atlas Antibodies

Catalog No.: ATL-HPA040038-25

Protein Description: KIAA1468
Gene Name: KIAA1468
Alternative Gene Name: FLJ33841, HsT3308, HsT885
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026319: 99%, ENSRNOG00000015508: 99%
Entrez Gene ID: 57614
Uniprot ID: Q9P260
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EAYSALSCCFISEDLMVNHFLPGLRCLRTDMEHLSPEHEVILSSMIKECEQKVENKTVQEPQGSMSIAASLVSEDTKTKF
• Gene Sequence: EAYSALSCCFISEDLMVNHFLPGLRCLRTDMEHLSPEHEVILSSMIKECEQKVENKTVQEPQGSMSIAASLVSEDTKTKF
• Gene ID - Mouse: ENSMUSG00000026319
• Gene ID - Rat: ENSRNOG00000015508
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti KIAA1468 pAb (ATL-HPA040038) – 1 Found

Gillingham, Alison K; Bertram, Jessie; Begum, Farida; Munro, Sean. In vivo identification of GTPase interactors by mitochondrial relocalization and proximity biotinylation. Elife. 2019;8( 31294692)