Anti KDM5C pAb (ATL-HPA046147)

Atlas Antibodies

Catalog No.: ATL-HPA046147-25

Protein Description: lysine (K)-specific demethylase 5C
Gene Name: KDM5C
Alternative Gene Name: DXS1272E, JARID1C, MRX13, SMCX, XE169
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025332: 98%, ENSRNOG00000057706: 91%
Entrez Gene ID: 8242
Uniprot ID: P41229
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LGLMAKDKTLRKKDKEGPECPPTVVVKEELGGDVKVESTSPKTFLESKEELSHSPEPCTKMTMRLRRNHSNAQFIESYVCRMCSRG
• Gene Sequence: LGLMAKDKTLRKKDKEGPECPPTVVVKEELGGDVKVESTSPKTFLESKEELSHSPEPCTKMTMRLRRNHSNAQFIESYVCRMCSRG
• Gene ID - Mouse: ENSMUSG00000025332
• Gene ID - Rat: ENSRNOG00000057706
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.