Anti KDF1 pAb (ATL-HPA068312)

Atlas Antibodies

SKU: ATL-HPA068312-25

• 

Protein Description: keratinocyte differentiation factor 1
Gene Name: KDF1
Alternative Gene Name: C1orf172, FLJ34633, RP11-344H11.3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037600: 88%, ENSRNOG00000058670: 90%
Entrez Gene ID: 126695
Uniprot ID: Q8NAX2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ANWAKEHNGVPPSPDRAPPSRRDGQRLKSTMGSSFSYPDVKLKGIPVYPYPRATSPAPDADSCCKEPLADPPPMRHSL
• Gene Sequence: ANWAKEHNGVPPSPDRAPPSRRDGQRLKSTMGSSFSYPDVKLKGIPVYPYPRATSPAPDADSCCKEPLADPPPMRHSL
• Gene ID - Mouse: ENSMUSG00000037600
• Gene ID - Rat: ENSRNOG00000058670
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.