Anti KCTD6 pAb (ATL-HPA036101 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA036101-25

Protein Description: potassium channel tetramerization domain containing 6
Gene Name: KCTD6
Alternative Gene Name: KCASH3, MGC27385
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021752: 100%, ENSRNOG00000007817: 100%
Entrez Gene ID: 200845
Uniprot ID: Q8NC69
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MDTRDCQVSFTFGPCDYHQEVSLRVHLMEYITKQGFTIRNTRVHHMSERANENTVEHNWTFCRLARKTDD
• Gene Sequence: MDTRDCQVSFTFGPCDYHQEVSLRVHLMEYITKQGFTIRNTRVHHMSERANENTVEHNWTFCRLARKTDD
• Gene ID - Mouse: ENSMUSG00000021752
• Gene ID - Rat: ENSRNOG00000007817
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.