Anti KCTD16 pAb (ATL-HPA044590 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA044590-25

Protein Description: potassium channel tetramerization domain containing 16
Gene Name: KCTD16
Alternative Gene Name: KIAA1317
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051401: 93%, ENSRNOG00000039063: 33%
Entrez Gene ID: 57528
Uniprot ID: Q68DU8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PDLVKLLTPDEIKQSPDEFCHSDFEDASQGSDTRICPPSSLLPADRKWGFITVGYRGSCTLGREGQADAKF
• Gene Sequence: PDLVKLLTPDEIKQSPDEFCHSDFEDASQGSDTRICPPSSLLPADRKWGFITVGYRGSCTLGREGQADAKF
• Gene ID - Mouse: ENSMUSG00000051401
• Gene ID - Rat: ENSRNOG00000039063
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.