Anti KCNV2 pAb (ATL-HPA031131)

Atlas Antibodies

Catalog No.: ATL-HPA031131-25

Protein Description: potassium channel, subfamily V, member 2
Gene Name: KCNV2
Alternative Gene Name: Kv8.2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047298: 66%, ENSRNOG00000012566: 65%
Entrez Gene ID: 169522
Uniprot ID: Q8TDN2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: WNTTENEGSQHRRSICSLGARSGSQASIHGWTEGNYNYYIEEDEDGEEEDQWKDDLAEEDQQAGEVTTAKPEGPSDPPALLSTLNVNVGGHSYQLDYCELA
• Gene Sequence: WNTTENEGSQHRRSICSLGARSGSQASIHGWTEGNYNYYIEEDEDGEEEDQWKDDLAEEDQQAGEVTTAKPEGPSDPPALLSTLNVNVGGHSYQLDYCELA
• Gene ID - Mouse: ENSMUSG00000047298
• Gene ID - Rat: ENSRNOG00000012566
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti KCNV2 pAb (ATL-HPA031131) – 1 Found

Gayet-Primo, Jacqueline; Yaeger, Daniel B; Khanjian, Roupen A; Puthussery, Teresa. Heteromeric K(V)2/K(V)8.2 Channels Mediate Delayed Rectifier Potassium Currents in Primate Photoreceptors. The Journal Of Neuroscience : The Official Journal Of The Society For Neuroscience. 2018;38(14):3414-3427.