Anti KCNH5 pAb (ATL-HPA072351)

Atlas Antibodies

Catalog No.: ATL-HPA072351-25

Protein Description: potassium voltage-gated channel subfamily H member 5
Gene Name: KCNH5
Alternative Gene Name: eag2, H-EAG2, Kv10.2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034402: 95%, ENSRNOG00000009542: 94%
Entrez Gene ID: 27133
Uniprot ID: Q8NCM2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SLKQNNRDAMELKPNGGADQKCLKVNSPIRMKNGNGKGWLRLKNNMGAHEEKKEDWNNVTKAESMGLLSEDPKSSDSENSVTK
• Gene Sequence: SLKQNNRDAMELKPNGGADQKCLKVNSPIRMKNGNGKGWLRLKNNMGAHEEKKEDWNNVTKAESMGLLSEDPKSSDSENSVTK
• Gene ID - Mouse: ENSMUSG00000034402
• Gene ID - Rat: ENSRNOG00000009542
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.