Anti KCNG1 pAb (ATL-HPA040024)

Atlas Antibodies

Catalog No.: ATL-HPA040024-25

Protein Description: potassium voltage-gated channel, subfamily G, member 1
Gene Name: KCNG1
Alternative Gene Name: K13, KCNG, kH2, Kv6.1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074575: 89%, ENSRNOG00000054314: 89%
Entrez Gene ID: 3755
Uniprot ID: Q9UIX4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ELKQEQERVMFRRAQFLIKTKSQLSVSQDSDILFGSASSDTRDNN
• Gene Sequence: ELKQEQERVMFRRAQFLIKTKSQLSVSQDSDILFGSASSDTRDNN
• Gene ID - Mouse: ENSMUSG00000074575
• Gene ID - Rat: ENSRNOG00000054314
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.