Anti KCNA1 pAb (ATL-HPA074471)

Atlas Antibodies

Catalog No.: ATL-HPA074471-25

Protein Description: potassium voltage-gated channel subfamily A member 1
Gene Name: KCNA1
Alternative Gene Name: AEMK, HUK1, Kv1.1, MBK1, RBK1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047976: 94%, ENSRNOG00000019750: 91%
Entrez Gene ID: 3736
Uniprot ID: Q09470
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QLLHVSSPNLASDSDLSRRSSSTMSKSEYMEIEEDMNNSIAHYRQVNIRTANCTTANQNCVNKSKLLTD
• Gene Sequence: QLLHVSSPNLASDSDLSRRSSSTMSKSEYMEIEEDMNNSIAHYRQVNIRTANCTTANQNCVNKSKLLTD
• Gene ID - Mouse: ENSMUSG00000047976
• Gene ID - Rat: ENSRNOG00000019750
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.