Anti KATNAL2 pAb (ATL-HPA042029 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA042029-25

Protein Description: katanin p60 subunit A-like 2
Gene Name: KATNAL2
Alternative Gene Name: DKFZP667C165, MGC33211
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025420: 92%, ENSRNOG00000017788: 94%
Entrez Gene ID: 83473
Uniprot ID: Q8IYT4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NAHPRRGQIIDFQGLLTDAIKGATSELALNTFDHNPDPSERLLKPLSAFIGMNSEMRELAAVVSRDIYLHNPNIKWNDIIGLDA
• Gene Sequence: NAHPRRGQIIDFQGLLTDAIKGATSELALNTFDHNPDPSERLLKPLSAFIGMNSEMRELAAVVSRDIYLHNPNIKWNDIIGLDA
• Gene ID - Mouse: ENSMUSG00000025420
• Gene ID - Rat: ENSRNOG00000017788
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.