Anti KANSL3 pAb (ATL-HPA035018)

Atlas Antibodies

Catalog No.: ATL-HPA035018-25

Protein Description: KAT8 regulatory NSL complex subunit 3
Gene Name: KANSL3
Alternative Gene Name: FLJ10081, KIAA1310, NSL3, Rcd1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000010453: 99%, ENSRNOG00000015417: 99%
Entrez Gene ID: 55683
Uniprot ID: Q9P2N6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PVLFVIGQNSLQCHPEAMEDFREKIRAENSLVVVGGADDNLRISKAKKKSEGLTQSMVDRCIQDEIVDFLTGVLTRAEGHMGSEPRDQDAEKKKKPR
• Gene Sequence: PVLFVIGQNSLQCHPEAMEDFREKIRAENSLVVVGGADDNLRISKAKKKSEGLTQSMVDRCIQDEIVDFLTGVLTRAEGHMGSEPRDQDAEKKKKPR
• Gene ID - Mouse: ENSMUSG00000010453
• Gene ID - Rat: ENSRNOG00000015417
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti KANSL3 pAb (ATL-HPA035018) – 5 Found

Meunier, Sylvain; Shvedunova, Maria; Van Nguyen, Nhuong; Avila, Leonor; Vernos, Isabelle; Akhtar, Asifa. An epigenetic regulator emerges as microtubule minus-end binding and stabilizing factor in mitosis. Nature Communications. 2015;6( 26243146):7889. 

Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23. 

Chelmicki, Tomasz; Dündar, Friederike; Turley, Matthew James; Khanam, Tasneem; Aktas, Tugce; Ramírez, Fidel; Gendrel, Anne-Valerie; Wright, Patrick Rudolf; Videm, Pavankumar; Backofen, Rolf; Heard, Edith; Manke, Thomas; Akhtar, Asifa. MOF-associated complexes ensure stem cell identity and Xist repression. Elife. 2014;3( 24842875):e02024. 

So, Chun; Seres, K Bianka; Steyer, Anna M; Mönnich, Eike; Clift, Dean; Pejkovska, Anastasija; Möbius, Wiebke; Schuh, Melina. A liquid-like spindle domain promotes acentrosomal spindle assembly in mammalian oocytes. Science (New York, N.y.). 2019;364(6447) 

Van, Hieu T; Harkins, Peter R; Patel, Avni; Jain, Abhinav K; Lu, Yue; Bedford, Mark T; Santos, Margarida A. Methyl-lysine readers PHF20 and PHF20L1 define two distinct gene expression-regulating NSL complexes. The Journal Of Biological Chemistry. 2022;298(3):101588.