Anti JMJD1C pAb (ATL-HPA066195)

Atlas Antibodies

Catalog No.: ATL-HPA066195-25

Protein Description: jumonji domain containing 1C
Gene Name: JMJD1C
Alternative Gene Name: DKFZp761F0118, FLJ14374, KIAA1380, TRIP8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037876: 86%, ENSRNOG00000000648: 82%
Entrez Gene ID: 221037
Uniprot ID: Q15652
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: IIPGSVLTDLLDAMHTLREKYGIKSHCHCTNKQNLQVGNFPTMNGVSQVLQNVLNHSNKISLCMPESQQQNTPPKS
• Gene Sequence: IIPGSVLTDLLDAMHTLREKYGIKSHCHCTNKQNLQVGNFPTMNGVSQVLQNVLNHSNKISLCMPESQQQNTPPKS
• Gene ID - Mouse: ENSMUSG00000037876
• Gene ID - Rat: ENSRNOG00000000648
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.