Anti JKAMP pAb (ATL-HPA031172)

Atlas Antibodies

Catalog No.: ATL-HPA031172-25

Protein Description: JNK1/MAPK8-associated membrane protein
Gene Name: JKAMP
Alternative Gene Name: C14orf100, CDA06, HSPC213, HSPC327, JAMP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005078: 100%, ENSRNOG00000004751: 100%
Entrez Gene ID: 51528
Uniprot ID: Q9P055
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LYIRSCRVLMLSDWYTMLYNPSPDYVTTVHCTH
• Gene Sequence: LYIRSCRVLMLSDWYTMLYNPSPDYVTTVHCTH
• Gene ID - Mouse: ENSMUSG00000005078
• Gene ID - Rat: ENSRNOG00000004751
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.