Anti JAKMIP2 pAb (ATL-HPA046929)

Atlas Antibodies

Catalog No.: ATL-HPA046929-25

Protein Description: janus kinase and microtubule interacting protein 2
Gene Name: JAKMIP2
Alternative Gene Name: JAMIP2, KIAA0555
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024502: 98%, ENSRNOG00000019159: 98%
Entrez Gene ID: 9832
Uniprot ID: Q96AA8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KLQVIEQQNIIDELTRDREKLIRRRKHRRSSKPIKRPVLDPFIGYDEDSMDSETSSMASFRTDRT
• Gene Sequence: KLQVIEQQNIIDELTRDREKLIRRRKHRRSSKPIKRPVLDPFIGYDEDSMDSETSSMASFRTDRT
• Gene ID - Mouse: ENSMUSG00000024502
• Gene ID - Rat: ENSRNOG00000019159
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.