Anti JAKMIP1 pAb (ATL-HPA044570 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA044570-25

Protein Description: janus kinase and microtubule interacting protein 1
Gene Name: JAKMIP1
Alternative Gene Name: FLJ31564, Gababrbp, JAMIP1, MARLIN1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000063646: 95%, ENSRNOG00000004998: 96%
Entrez Gene ID: 152789
Uniprot ID: Q96N16
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LVEKNKRMNKKNEDLLQSIQRMEEKIKNLTRENVEMKEKLSAQASLKRHTSLNDLSLTRDEQEIEFLRLQVLEQQHVIDDLSL
• Gene Sequence: LVEKNKRMNKKNEDLLQSIQRMEEKIKNLTRENVEMKEKLSAQASLKRHTSLNDLSLTRDEQEIEFLRLQVLEQQHVIDDLSL
• Gene ID - Mouse: ENSMUSG00000063646
• Gene ID - Rat: ENSRNOG00000004998
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.