Anti IZUMO2 pAb (ATL-HPA042143)

Atlas Antibodies

Catalog No.: ATL-HPA042143-25

Protein Description: IZUMO family member 2
Gene Name: IZUMO2
Alternative Gene Name: C19orf41, MGC33947, SCRL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000066500: 62%, ENSRNOG00000047254: 62%
Entrez Gene ID: 126123
Uniprot ID: Q6UXV1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PSRFQLEQLQARAGAVLMGMEGPFFRDYALNVFVGKVETNQLDLVASFVKNQTQHLMGNSLKDEPLLEELVTLR
• Gene Sequence: PSRFQLEQLQARAGAVLMGMEGPFFRDYALNVFVGKVETNQLDLVASFVKNQTQHLMGNSLKDEPLLEELVTLR
• Gene ID - Mouse: ENSMUSG00000066500
• Gene ID - Rat: ENSRNOG00000047254
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.