Anti IYD pAb (ATL-HPA059627 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA059627-25

Protein Description: iodotyrosine deiodinase
Gene Name: IYD
Alternative Gene Name: C6orf71, DEHAL1, dJ422F24.1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019762: 66%, ENSRNOG00000016286: 65%
Entrez Gene ID: 389434
Uniprot ID: Q6PHW0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ADRSMEKKKGEPRTRAEARPWVDEDLKDSSDLHQAEEDADEWQESEENVEHIPFSHNHYPEK
• Gene Sequence: ADRSMEKKKGEPRTRAEARPWVDEDLKDSSDLHQAEEDADEWQESEENVEHIPFSHNHYPEK
• Gene ID - Mouse: ENSMUSG00000019762
• Gene ID - Rat: ENSRNOG00000016286
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.