Anti ITPR2 pAb (ATL-HPA059144)

Atlas Antibodies

Catalog No.: ATL-HPA059144-25

Protein Description: inositol 1,4,5-trisphosphate receptor, type 2
Gene Name: ITPR2
Alternative Gene Name: CFAP48, IP3R2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030287: 85%, ENSRNOG00000053339: 79%
Entrez Gene ID: 3709
Uniprot ID: Q14571
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KDDFTMEVDRLKNRTPVTGSHQVPTMTLTTMMEACAKENCSPTIPASNTADEEYEDGIERTC
• Gene Sequence: KDDFTMEVDRLKNRTPVTGSHQVPTMTLTTMMEACAKENCSPTIPASNTADEEYEDGIERTC
• Gene ID - Mouse: ENSMUSG00000030287
• Gene ID - Rat: ENSRNOG00000053339
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.