Anti ITPR1 pAb (ATL-HPA016487)

Atlas Antibodies

Catalog No.: ATL-HPA016487-25

Protein Description: inositol 1,4,5-trisphosphate receptor, type 1
Gene Name: ITPR1
Alternative Gene Name: ACV, Insp3r1, IP3R1, PPP1R94, SCA15, SCA16, SCA29
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030102: 99%, ENSRNOG00000007104: 99%
Entrez Gene ID: 3708
Uniprot ID: Q14643
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FFKVFYDRMKVAQQEIKATVTVNTSDLGNKKKDDEVDRDAPSRKKAKEPTTQITEEVRDQLLEASAATRKAFTTFRREADPDDHYQPGEGTQATADKAKDDLEMSAVITIMQPILRFLQLLCENHNRDLQNFLRC
• Gene Sequence: FFKVFYDRMKVAQQEIKATVTVNTSDLGNKKKDDEVDRDAPSRKKAKEPTTQITEEVRDQLLEASAATRKAFTTFRREADPDDHYQPGEGTQATADKAKDDLEMSAVITIMQPILRFLQLLCENHNRDLQNFLRC
• Gene ID - Mouse: ENSMUSG00000030102
• Gene ID - Rat: ENSRNOG00000007104
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ITPR1 pAb (ATL-HPA016487) – 1 Found

Klar, Joakim; Hisatsune, Chihiro; Baig, Shahid M; Tariq, Muhammad; Johansson, Anna C V; Rasool, Mahmood; Malik, Naveed Altaf; Ameur, Adam; Sugiura, Kotomi; Feuk, Lars; Mikoshiba, Katsuhiko; Dahl, Niklas. Abolished InsP3R2 function inhibits sweat secretion in both humans and mice. The Journal Of Clinical Investigation. 2014;124(11):4773-80.