Anti ITGB1BP1 pAb (ATL-HPA067348)

Atlas Antibodies

Catalog No.: ATL-HPA067348-25

Protein Description: integrin subunit beta 1 binding protein 1
Gene Name: ITGB1BP1
Alternative Gene Name: ICAP-1A, ICAP-1alpha, ICAP-1B, ICAP1, ICAP1A, ICAP1B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000062352: 96%, ENSRNOG00000059402: 96%
Entrez Gene ID: 9270
Uniprot ID: O14713
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VSKYGIKVSTSDQYDVLHRHALYLIIRMVCYDDGLGAGKSLLALKTTDASNEEYSLWVYQCNSLEQAQAICKVLSTAFDSVLT
• Gene Sequence: VSKYGIKVSTSDQYDVLHRHALYLIIRMVCYDDGLGAGKSLLALKTTDASNEEYSLWVYQCNSLEQAQAICKVLSTAFDSVLT
• Gene ID - Mouse: ENSMUSG00000062352
• Gene ID - Rat: ENSRNOG00000059402
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.