Anti ITGB1 pAb (ATL-HPA059297 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA059297-100

Protein Description: integrin subunit beta 1
Gene Name: ITGB1
Alternative Gene Name: CD29, FNRB, GPIIA, MDF2, MSK12
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025809: 91%, ENSRNOG00000010966: 91%
Entrez Gene ID: 3688
Uniprot ID: P05556
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KANAKSCGECIQAGPNCGWCTNSTFLQEGMPTSARCDDLEALKKKGCPPDDIENPRGSKDIKKNKNVTNRSKGTAEKLKPEDITQIQPQQLVLRLRSGEP
• Gene Sequence: KANAKSCGECIQAGPNCGWCTNSTFLQEGMPTSARCDDLEALKKKGCPPDDIENPRGSKDIKKNKNVTNRSKGTAEKLKPEDITQIQPQQLVLRLRSGEP
• Gene ID - Mouse: ENSMUSG00000025809
• Gene ID - Rat: ENSRNOG00000010966
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.