Anti ITGAE pAb (ATL-HPA052147 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA052147-25

Protein Description: integrin subunit alpha E
Gene Name: ITGAE
Alternative Gene Name: CD103, HUMINAE
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005947: 60%, ENSRNOG00000046639: 60%
Entrez Gene ID: 3682
Uniprot ID: P38570
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GGAPFVLSSLLHQDPSTNQTWLLVTSPRTKRTPGPLHRCSLVQDEILCHPVEHVPIPKGRHRGVTVVRSHHGVLICIQVLVRRPHSLSSELTGTCSLLGPDLRPQAQANFFDLENLLDPDARVDTGDCYSNK
• Gene Sequence: GGAPFVLSSLLHQDPSTNQTWLLVTSPRTKRTPGPLHRCSLVQDEILCHPVEHVPIPKGRHRGVTVVRSHHGVLICIQVLVRRPHSLSSELTGTCSLLGPDLRPQAQANFFDLENLLDPDARVDTGDCYSNK
• Gene ID - Mouse: ENSMUSG00000005947
• Gene ID - Rat: ENSRNOG00000046639
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.