Anti ITGA2B pAb (ATL-HPA031169 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA031169-25

Protein Description: integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigen CD41)
Gene Name: ITGA2B
Alternative Gene Name: CD41, CD41B, GP2B, PPP1R93
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034664: 74%, ENSRNOG00000022071: 76%
Entrez Gene ID: 3674
Uniprot ID: P08514
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NDFSWDKRYCEAGFSSVVTQAGELVLGAPGGYYFLGLLAQAPVADIFSSYRPGILLWHVSSQSLSFDSSNPEYFDGYWGYSVAVGEFDGDLNTTEYVVG
• Gene Sequence: NDFSWDKRYCEAGFSSVVTQAGELVLGAPGGYYFLGLLAQAPVADIFSSYRPGILLWHVSSQSLSFDSSNPEYFDGYWGYSVAVGEFDGDLNTTEYVVG
• Gene ID - Mouse: ENSMUSG00000034664
• Gene ID - Rat: ENSRNOG00000022071
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.