Anti ITFG2 pAb (ATL-HPA038665)

Atlas Antibodies

Catalog No.: ATL-HPA038665-25

Protein Description: integrin alpha FG-GAP repeat containing 2
Gene Name: ITFG2
Alternative Gene Name: MDS028
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001518: 94%, ENSRNOG00000006264: 93%
Entrez Gene ID: 55846
Uniprot ID: Q969R8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KVLDASGHHETLIGEEQRPVFKQHIPANTKVMLISDIDGDGCRELVVGYTDRVVRAFRWEELGEGPEHLTGQLVSLKKWMLEGQVDSLSVTLGPL
• Gene Sequence: KVLDASGHHETLIGEEQRPVFKQHIPANTKVMLISDIDGDGCRELVVGYTDRVVRAFRWEELGEGPEHLTGQLVSLKKWMLEGQVDSLSVTLGPL
• Gene ID - Mouse: ENSMUSG00000001518
• Gene ID - Rat: ENSRNOG00000006264
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.