Anti ISLR pAb (ATL-HPA050811)

Atlas Antibodies

Catalog No.: ATL-HPA050811-25

Protein Description: immunoglobulin superfamily containing leucine-rich repeat
Gene Name: ISLR
Alternative Gene Name: HsT17563
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037206: 87%, ENSRNOG00000048924: 91%
Entrez Gene ID: 3671
Uniprot ID: O14498
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LLIPDFGKLEEGTYSCLATNELGSAESSVDVALATPGEGGEDTLGRRFHGKAVEGKGCYTVDNEVQPSGPEDNVVIIYLSRAGNPEAAVAEGVPG
• Gene Sequence: LLIPDFGKLEEGTYSCLATNELGSAESSVDVALATPGEGGEDTLGRRFHGKAVEGKGCYTVDNEVQPSGPEDNVVIIYLSRAGNPEAAVAEGVPG
• Gene ID - Mouse: ENSMUSG00000037206
• Gene ID - Rat: ENSRNOG00000048924
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ISLR pAb (ATL-HPA050811) – 1 Found

Zhang, Kuo; Zhang, Yuying; Gu, Lijie; Lan, Miaomiao; Liu, Chuncheng; Wang, Meng; Su, Yang; Ge, Mengxu; Wang, Tongtong; Yu, Yingying; Liu, Chang; Li, Lei; Li, Qiuyan; Zhao, Yaofeng; Yu, Zhengquan; Wang, Fudi; Li, Ning; Meng, Qingyong. Islr regulates canonical Wnt signaling-mediated skeletal muscle regeneration by stabilizing Dishevelled-2 and preventing autophagy. Nature Communications. 2018;9(1):5129.