Anti IQSEC1 pAb (ATL-HPA038143)

Atlas Antibodies

Catalog No.: ATL-HPA038143-25

Protein Description: IQ motif and Sec7 domain 1
Gene Name: IQSEC1
Alternative Gene Name: ARF-GEP100, BRAG2, GEP100, KIAA0763
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034312: 91%, ENSRNOG00000060350: 91%
Entrez Gene ID: 9922
Uniprot ID: Q6DN90
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PSSETGTSLDSPSAYPQGPLVPGSSLSPDHYEHTSVGAYGLYSGPPGQQQRTRRPKLQHSTSILRKQAE
• Gene Sequence: PSSETGTSLDSPSAYPQGPLVPGSSLSPDHYEHTSVGAYGLYSGPPGQQQRTRRPKLQHSTSILRKQAE
• Gene ID - Mouse: ENSMUSG00000034312
• Gene ID - Rat: ENSRNOG00000060350
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.