Anti INTS7 pAb (ATL-HPA072611)

Atlas Antibodies

SKU: ATL-HPA072611-25

• 

Protein Description: integrator complex subunit 7
Gene Name: INTS7
Alternative Gene Name: C1orf73, DKFZP434B168, INT7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037461: 95%, ENSRNOG00000004263: 95%
Entrez Gene ID: 25896
Uniprot ID: Q9NVH2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GDGMLGDLMELYKVIGRSATDKQQELLVSLATVIFVASQKALSVESKAVIKQQLESVSNGWTVYRIARQASRMGNHDMAKELYQSLLTQVA
• Gene Sequence: GDGMLGDLMELYKVIGRSATDKQQELLVSLATVIFVASQKALSVESKAVIKQQLESVSNGWTVYRIARQASRMGNHDMAKELYQSLLTQVA
• Gene ID - Mouse: ENSMUSG00000037461
• Gene ID - Rat: ENSRNOG00000004263
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.