Anti INTS14 pAb (ATL-HPA040255 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA040255-25

Protein Description: integrator complex subunit 14
Gene Name: INTS14
Alternative Gene Name: C15orf44, DKFZP564O1664, VWA9
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034263: 97%, ENSRNOG00000012469: 97%
Entrez Gene ID: 81556
Uniprot ID: Q96SY0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LTADVQVFPRPEPFVVDEEIDPIPKVINTDLEIVGFIDIADISSPPVLSRHLVLPIALNKEGDEVGTGITDDNEDENSANQIAGKIPNFCVLLHGSLKVEGMVAIVQL
• Gene Sequence: LTADVQVFPRPEPFVVDEEIDPIPKVINTDLEIVGFIDIADISSPPVLSRHLVLPIALNKEGDEVGTGITDDNEDENSANQIAGKIPNFCVLLHGSLKVEGMVAIVQL
• Gene ID - Mouse: ENSMUSG00000034263
• Gene ID - Rat: ENSRNOG00000012469
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti INTS14 pAb (ATL-HPA040255 w/enhanced validation) – 2 Found

Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23. 

Tanaka, Yosuke; Kambayashi, Hidetaka; Yamamoto, Akiko; Onishi, Iichiroh; Sugita, Keisuke; Matsumura, Miwa; Ishibashi, Sachiko; Ikeda, Masumi; Yamamoto, Kouhei; Kitagawa, Masanobu; Kurata, Morito. Efficient Identification of the MYC Regulator with the Use of the CRISPR Library and Context-Matched Database Screenings. International Journal Of Molecular Sciences. 2022;23(14)