Anti INTS12 pAb (ATL-HPA035772)

Atlas Antibodies

Catalog No.: ATL-HPA035772-25

Protein Description: integrator complex subunit 12
Gene Name: INTS12
Alternative Gene Name: INT12, PHF22, SBBI22
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028016: 90%, ENSRNOG00000011844: 91%
Entrez Gene ID: 57117
Uniprot ID: Q96CB8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KRPADKMKSDITEGVDIPKKPRLEKPETQSSPITVQSSKDLPMADLSSFEETSADDFAMEMGLACVVCRQMMVASGNQLVECQECHNLYHRDCH
• Gene Sequence: KRPADKMKSDITEGVDIPKKPRLEKPETQSSPITVQSSKDLPMADLSSFEETSADDFAMEMGLACVVCRQMMVASGNQLVECQECHNLYHRDCH
• Gene ID - Mouse: ENSMUSG00000028016
• Gene ID - Rat: ENSRNOG00000011844
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti INTS12 pAb (ATL-HPA035772) – 1 Found

Obeidat, Ma'en; Miller, Suzanne; Probert, Kelly; Billington, Charlotte K; Henry, Amanda P; Hodge, Emily; Nelson, Carl P; Stewart, Ceri E; Swan, Caroline; Wain, Louise V; Soler Artigas, María; Melén, Erik; Ushey, Kevin; Hao, Ke; Lamontagne, Maxime; Bossé, Yohan; Postma, Dirkje S; Tobin, Martin D; Sayers, Ian; Hall, Ian P. GSTCD and INTS12 regulation and expression in the human lung. Plos One. 8(9):e74630.