Anti INTS10 pAb (ATL-HPA039129)

Atlas Antibodies

Catalog No.: ATL-HPA039129-25

Protein Description: integrator complex subunit 10
Gene Name: INTS10
Alternative Gene Name: C8orf35, FLJ10569, INT10
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031864: 85%, ENSRNOG00000055331: 85%
Entrez Gene ID: 55174
Uniprot ID: Q9NVR2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KGRRSYGDILHRMKDLCRYMNNFDSEAHAKYKNQVVYSTMLVFFKNAFQYVNSIQPSLFQGPNAPSQVPLVLLEDVSNVYGD
• Gene Sequence: KGRRSYGDILHRMKDLCRYMNNFDSEAHAKYKNQVVYSTMLVFFKNAFQYVNSIQPSLFQGPNAPSQVPLVLLEDVSNVYGD
• Gene ID - Mouse: ENSMUSG00000031864
• Gene ID - Rat: ENSRNOG00000055331
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.