Anti INPPL1 pAb (ATL-HPA037601)

Atlas Antibodies

Catalog No.: ATL-HPA037601-25

Protein Description: inositol polyphosphate phosphatase-like 1
Gene Name: INPPL1
Alternative Gene Name: SHIP2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032737: 94%, ENSRNOG00000019730: 94%
Entrez Gene ID: 3636
Uniprot ID: O15357
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TLGELIGLYAQPNQGLVCALLLPVEGEREPDPPDDRDASDGEDEKPPLPPRSGSTSISAPTGPSSPLPAPETPTAPAAESAPNGLST
• Gene Sequence: TLGELIGLYAQPNQGLVCALLLPVEGEREPDPPDDRDASDGEDEKPPLPPRSGSTSISAPTGPSSPLPAPETPTAPAAESAPNGLST
• Gene ID - Mouse: ENSMUSG00000032737
• Gene ID - Rat: ENSRNOG00000019730
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.