Anti INO80C pAb (ATL-HPA049060 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA049060-25

Protein Description: INO80 complex subunit C
Gene Name: INO80C
Alternative Gene Name: C18orf37, FLJ38183, hIes6, IES6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047989: 86%, ENSRNOG00000016532: 87%
Entrez Gene ID: 125476
Uniprot ID: Q6PI98
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC, ChIP-Exo-Seq
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GYGASKKKKASASSFAQGISMEAMSENKMVPSEFSTGPVEKAAKPLPFKDPNFVHSGHGGAVAGKKNRT
• Gene Sequence: GYGASKKKKASASSFAQGISMEAMSENKMVPSEFSTGPVEKAAKPLPFKDPNFVHSGHGGAVAGKKNRT
• Gene ID - Mouse: ENSMUSG00000047989
• Gene ID - Rat: ENSRNOG00000016532
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.