Anti IMPACT pAb (ATL-HPA041968 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA041968-25

Protein Description: impact RWD domain protein
Gene Name: IMPACT
Alternative Gene Name: RWDD5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024423: 98%, ENSRNOG00000045844: 98%
Entrez Gene ID: 55364
Uniprot ID: Q9P2X3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ENKKIASATHNIYAYRIYCEDKQTFLQDCEDDGETAAGGRLLHLMEILNVKNVMVVV
• Gene Sequence: ENKKIASATHNIYAYRIYCEDKQTFLQDCEDDGETAAGGRLLHLMEILNVKNVMVVV
• Gene ID - Mouse: ENSMUSG00000024423
• Gene ID - Rat: ENSRNOG00000045844
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.