Anti IMPA1 pAb (ATL-HPA037489 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA037489-25

Protein Description: inositol(myo)-1(or 4)-monophosphatase 1
Gene Name: IMPA1
Alternative Gene Name: IMPA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027531: 95%, ENSRNOG00000010482: 92%
Entrez Gene ID: 3612
Uniprot ID: P29218
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: CIPVHGIRSVGTAAVNMCLVATGGADAYYEMGIHCWDVAGAGIIVTEAGGVLMDVTGGPF
• Gene Sequence: CIPVHGIRSVGTAAVNMCLVATGGADAYYEMGIHCWDVAGAGIIVTEAGGVLMDVTGGPF
• Gene ID - Mouse: ENSMUSG00000027531
• Gene ID - Rat: ENSRNOG00000010482
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti IMPA1 pAb (ATL-HPA037489 w/enhanced validation) – 1 Found

Basso, Emy; Rigotto, Giulia; Zucchetti, Andrés E; Pozzan, Tullio. Slow activation of fast mitochondrial Ca(2+) uptake by cytosolic Ca(2). The Journal Of Biological Chemistry. 2018;293(44):17081-17094.