Anti IMP4 pAb (ATL-HPA066673)

Atlas Antibodies

Catalog No.: ATL-HPA066673-25

Protein Description: IMP4, U3 small nucleolar ribonucleoprotein
Gene Name: IMP4
Alternative Gene Name: BXDC4, MGC19606
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026127: 98%, ENSRNOG00000013285: 98%
Entrez Gene ID: 92856
Uniprot ID: Q96G21
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NRLIPTELRREALALQGSLEFDDAGGEGVTSHVDDEYRWAGVEDPKVMITTSRDPSSRLKMFAKE
• Gene Sequence: NRLIPTELRREALALQGSLEFDDAGGEGVTSHVDDEYRWAGVEDPKVMITTSRDPSSRLKMFAKE
• Gene ID - Mouse: ENSMUSG00000026127
• Gene ID - Rat: ENSRNOG00000013285
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.