Anti IMMT pAb (ATL-HPA036164 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA036164-25

Protein Description: inner membrane protein, mitochondrial
Gene Name: IMMT
Alternative Gene Name: HMP, MINOS2, P87, P89
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052337: 97%, ENSRNOG00000009097: 95%
Entrez Gene ID: 10989
Uniprot ID: Q16891
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VAMIDETRNSLYQYFLSYLQSLLLFPPQQLKPPPELCPEDINTFKLLSYASYCIEHGDLELAAKFVNQLKGESRRVAQDWLKEARM
• Gene Sequence: VAMIDETRNSLYQYFLSYLQSLLLFPPQQLKPPPELCPEDINTFKLLSYASYCIEHGDLELAAKFVNQLKGESRRVAQDWLKEARM
• Gene ID - Mouse: ENSMUSG00000052337
• Gene ID - Rat: ENSRNOG00000009097
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.